PDB entry 3bqc

View 3bqc on RCSB PDB site
Description: High pH-value crystal structure of emodin in complex with the catalytic subunit of protein kinase CK2
Class: Transferase
Keywords: protein kinase CK2, casein kinase 2, eukaryotic protein kinases, emodin, ATP-competitive inhibitor, ATP-binding, Nucleotide-binding, Serine/threonine-protein kinase, Transferase, Wnt signaling pathway
Deposited on 2007-12-20, released 2008-01-15
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-18, with a file datestamp of 2008-03-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.133
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: HOMO SAPIENS
    Gene: csnk2a1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bqca1
  • Heterogens: CL, EMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bqcA (A:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bqcA (A:)
    gpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
    ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
    qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
    hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
    vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
    kllrydhqsrltareamehpyfytvvkd