PDB entry 3bq0

View 3bq0 on RCSB PDB site
Description: Pre-insertion binary complex of Dbh DNA polymerase
Class: transferase/DNA
Keywords: DNA polymerase, Y-family, lesion bypass, single-base deletion, -1 frameshift, DNA damage, DNA repair, DNA replication, DNA-binding, DNA-directed DNA polymerase, Magnesium, Metal-binding, Mutator protein, Nucleotidyltransferase, Transferase, TRANSFERASE/DNA, TRANSFERASE-DNA complex
Deposited on 2007-12-19, released 2008-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: DBH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bq0a1, d3bq0a2
  • Chain 'P':
    Compound: DNA (5'-d(*dgp*dap*dap*dgp*dcp*dcp*dgp*dgp*dcp*dg)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'T':
    Compound: DNA (5'-d(*dt*dtp*dcp*dcp*dgp*dcp*dcp*dcp*dgp*dgp*dcp*dtp*dtp*dcp*dc)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bq0A (A:)
    mivifvdfdyffaqveevlnpqykgkplvvcvysgrtktsgavatanyearklgvkagmp
    iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
    ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
    ideipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepven
    kskiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgk
    kfkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiinktnlsdffdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bq0A (A:)
    mivifvdfdyffaqveevlnpqykgkplvvcvysgtsgavatanyearklgvkagmpiik
    amqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfengi
    elarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneldide
    ipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepvenksk
    iphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgkkfk
    hgisidnaykvaedllrellvrdkrrnvrrigvkldniiin
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.