PDB entry 3bpx

View 3bpx on RCSB PDB site
Description: Crystal Structure of MarR
Class: transcription regulator
Keywords: MarR, transcription factor, Winged Helix Motif, DNA binding,DNA-binding, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2007-12-19, released 2008-05-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.222
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Methanobacterium thermoautotrophicum
    Gene: MT313
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26413 (3-147)
      • expression tag (1-2)
    Domains in SCOPe 2.03: d3bpxa_
  • Chain 'B':
    Compound: Transcriptional regulator
    Species: Methanobacterium thermoautotrophicum
    Gene: MT313
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3bpxb_
  • Heterogens: NA, SAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bpxA (A:)
    gshmdrdiplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatff
    hvdkgtiartlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfr
    dftederklfrkmcrrlaeeavrmrgew
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bpxA (A:)
    shmdrdiplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatffh
    vdkgtiartlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfrd
    ftederklfrkmcrrlaeeavrmrgew
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bpxB (B:)
    gshmdrdiplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatff
    hvdkgtiartlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfr
    dftederklfrkmcrrlaeeavrmrgew
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bpxB (B:)
    diplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatffhvdkgt
    iartlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfrdftede
    rklfrkmcrrlaeeavrm