PDB entry 3bpw

View 3bpw on RCSB PDB site
Description: Crystal Structure of P. falciparum Orotidine 5'-monophosphate Decarboxylase Complexed with XMP
Class: lyase
Keywords: P. falciparum, Orotidine 5'-monophosphate Decarboxylase, XMP, Lyase, Pyrimidine biosynthesis
Deposited on 2007-12-19, released 2008-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ompdc
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6J6 (19-341)
      • expression tag (12-18)
    Domains in SCOPe 2.07: d3bpwa1, d3bpwa2
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ompdc
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6J6 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d3bpwb1, d3bpwb2
  • Heterogens: PO4, XMP, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bpwA (A:)
    mgsshhhhhhssglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekenny
    nnikknlkekyinnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltf
    kmnfafyipygsvgidvlknvfdylyelniptildmkindigntvknyrkfifeylksds
    ctvniymgtnmlkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqea
    lnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngy
    hksyekilinigraitknpypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bpwA (A:)
    glvprgsmgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyi
    nnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygs
    vgidvlknvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnml
    kdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqn
    nefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinig
    raitknpypqkaaqmyydqinailkqnmes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bpwB (B:)
    mgsshhhhhhssglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekenny
    nnikknlkekyinnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltf
    kmnfafyipygsvgidvlknvfdylyelniptildmkindigntvknyrkfifeylksds
    ctvniymgtnmlkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqea
    lnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngy
    hksyekilinigraitknpypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bpwB (B:)
    smgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsik
    kdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvl
    knvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyd
    eeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigf
    vvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitkn
    pypqkaaqmyydqinailkqn