PDB entry 3bpv

View 3bpv on RCSB PDB site
Description: Crystal Structure of MarR
Class: transcription regulator
Keywords: MarR, DNA binding, transcription factor, Winged Helix Motif, DNA-binding, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2007-12-19, released 2008-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.243
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Methanobacterium thermoautotrophicum
    Gene: MTH313,MTH_313
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bpva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bpvA (A:)
    iplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatffhvdkgti
    artlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfrdfteder
    klfrkmcrrlaeeavrmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bpvA (A:)
    iplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatffhvdkgti
    artlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfrdfteder
    klfrkmcrrlaeeavrm