PDB entry 3bps

View 3bps on RCSB PDB site
Description: PCSK9:EGF-A complex
Class: HYDROLASE/Lipid Transport
Keywords: PCSK9, LDL receptor, Alternative splicing, Autocatalytic cleavage, Calcium, Cholesterol metabolism, Disease mutation, Glycoprotein, Hydrolase, Lipid metabolism, Phosphoprotein, Polymorphism, Protease, Secreted, Serine protease, Steroid metabolism, Zymogen, Coated pit, EGF-like domain, Endocytosis, Host-virus interaction, Lipid transport, Membrane, Transmembrane, Transport, HYDROLASE/Lipid Transport COMPLEX
Deposited on 2007-12-19, released 2008-02-12
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-26, with a file datestamp of 2008-02-22.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.205
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: HOMO SAPIENS
    Gene: PCSK9, NARC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: low-density lipoprotein receptor
    Species: HOMO SAPIENS
    Gene: LDLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01130 (3-End)
      • expression tag (2)
    Domains in SCOP 1.75: d3bpse1
  • Chain 'P':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: HOMO SAPIENS
    Gene: PCSK9, NARC1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >3bpsE (E:)
gamgtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvn
leggykcqceegfqldphtkack

    Sequence, based on observed residues (ATOM records): (download) 
    >3bpsE (E:)
mgtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrce

  • Chain 'P':
    No sequence available.