PDB entry 3bpo

View 3bpo on RCSB PDB site
Description: Crystal structure of the IL13-IL4R-IL13Ra ternary complex
Class: Cytokine/Cytokine receptor
Keywords: IL4, IL13, IL4R, IL13R, cytokine, receptor, Glycoprotein, Immune response, Membrane, Phosphoprotein, Secreted, Transmembrane, Cytokine-Cytokine receptor COMPLEX
Deposited on 2007-12-18, released 2008-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.256
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin 13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bpoa_
  • Chain 'B':
    Compound: Interleukin-4 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL4R, 582J2.1, IL4RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24394 (4-End)
      • expression tag (1-3)
      • engineered (30)
      • engineered (75)
      • engineered (111)
      • engineered (153)
    Domains in SCOPe 2.07: d3bpob1, d3bpob2, d3bpob3
  • Chain 'C':
    Compound: Interleukin-13 receptor alpha-1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13RA1, IL13R, IL13RA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bpoA (A:)
    pgpvppstalrelieelvnitqnqkaplcngsmvwsinlttagmycaaleslinvsgcsa
    iektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregqfnrnfesi
    iicrdrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bpoA (A:)
    gpvppstalrelieelvnitqaplcngsmvwsinagmycaaleslinvsgcsaiektqrm
    lsgfcphslhvrdtkievaqfvkdlllhlkklfregqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bpoB (B:)
    adpfkvlqeptcvsdymsistcewkmngptqcstelrllyqlvfllseahtcipenngga
    gcvchllmddvvsadqytldlwagqqllwkgsfkpsehvkprapgnltvhtqvsdtlllt
    wsnpyppdnylynhltyavniwsendpadfriyqvtylepslriaastlksgisyrarvr
    awaqcynttwsewspstkwhnsyre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bpoB (B:)
    dpfkvlqeptcvsdymsistcewkmngptqcstelrllyqlvfllseahtcipennggag
    cvchllmddvvsadqytldlwagqqllwkgsfkpsehvkprapgnltvhtqvsdtllltw
    snpyppdnylynhltyavniwsendpadfriyqvtylepslriaastlksgisyrarvra
    waqcynttwsewspstkw
    

  • Chain 'C':
    No sequence available.