PDB entry 3bo3

View 3bo3 on RCSB PDB site
Description: A relaxed active site following exon ligation by a group I intron
Class: nuclear protein/RNA
Keywords: group I intron, azoarcus, ribozyme, ligation, Acetylation, mRNA processing, mRNA splicing, Nucleus, Ribonucleoprotein, RNA-binding, Spliceosome, NUCLEAR PROTEIN/RNA COMPLEX
Deposited on 2007-12-17, released 2008-04-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.284
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-94)
      • engineered (27)
      • engineered (32)
    Domains in SCOPe 2.04: d3bo3a1
  • Chain 'B':
    Compound: Group I intron P9
  • Chain 'C':
    Compound: RNA (5'-r(*ap*ap*gp*cp*cp*ap*cp*ap*cp*ap*ap*ap*cp*cp*ap*g)-3')
  • Chain 'D':
    Compound: RNA (5'-r(*cp*ap*up*ap*cp*gp*gp*cp*c)-3')
  • Heterogens: MG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bo3A (A:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.