PDB entry 3bnw

View 3bnw on RCSB PDB site
Description: Crystal structure of riboflavin kinase from Trypanosoma brucei
Class: transferase
Keywords: apo structure, Structural Genomics, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, Kinase, TRANSFERASE
Deposited on 2007-12-14, released 2008-01-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase, putative
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb09.211.3420
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38DG4 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.08: d3bnwa1, d3bnwa2
  • Chain 'B':
    Compound: Riboflavin kinase, putative
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb09.211.3420
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bnwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bnwA (A:)
    mahhhhhhmrqtgsfqpfflrgkvvhgkgrggsqlgfptanigldkdvmeclqpyknlvv
    ygwgtvsqvpgkeresfgpypfaasigfnmqfdektltvepyflhefgwdfygavvkiiv
    lgeirsmgsfhslqalvdtiksdvqftrdmlqkpqlqefsrhslfespsstipyfedlpd
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bnwA (A:)
    hmrqtgsfqpfflrgkvvhsqlgfptanigldkdvmeclqpyknlvvygwgtvsqvpgke
    resfgpypfaasigfntltvepyflhefgwdfygavvkiivlgeirsmgsfhslqalvdt
    iksdvqftrdmlqkpqlqefsrhslfespsstipyfedlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bnwB (B:)
    mahhhhhhmrqtgsfqpfflrgkvvhgkgrggsqlgfptanigldkdvmeclqpyknlvv
    ygwgtvsqvpgkeresfgpypfaasigfnmqfdektltvepyflhefgwdfygavvkiiv
    lgeirsmgsfhslqalvdtiksdvqftrdmlqkpqlqefsrhslfespsstipyfedlpd
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bnwB (B:)
    gsfqpfflrgkvvhgsqlgfptanigldkdvmeclqpyknlvvygwgtvsqvpgkeresf
    gpypfaasigfektltvepyflhefgwdfygavvkiivlgeirsmgsfhslqalvdtiks
    dvqftrdmlqkpqlqefsrhslfespsstipyfedlp