PDB entry 3bn6

View 3bn6 on RCSB PDB site
Description: Crystal Structure of the C2 Domain of Bovine Lactadherin at 1.67 Angstrom Resolution
Class: blood clotting, cell adhesion
Keywords: anticoagulation, anti-coagulation, anticoagulant, anti-coagulant, membrane binding, phosphatidyl-serine binding, phosphatidylserine binding, Blood coagulation Factor V C2 homologue, Blood coagulation Factor VIII C2 homologue, milk fat globule, apoptosis, discoidin domain, FA58C, F5_F8_type_C, Alternative splicing, Cell adhesion, EGF-like domain, Fertilization, Glycoprotein, BLOOD CLOTTING
Deposited on 2007-12-13, released 2007-12-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.19
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactadherin
    Species: Bos taurus [TaxId:9913]
    Gene: MFGE8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3bn6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bn6A (A:)
    cteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasewl
    qidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnmd
    nnshkknifetpfqarfvriqpvawhnritlrvellgc