PDB entry 3bn3

View 3bn3 on RCSB PDB site
Description: crystal structure of ICAM-5 in complex with aL I domain
Class: Cell adhesion, immune system
Keywords: ICAM-5, I domain, integrin, allosteric mobility, Cell adhesion, immune system
Deposited on 2007-12-13, released 2008-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (1-179)
      • initiating methionine (0)
      • variant (61)
      • engineered (137)
      • engineered (164)
    Domains in SCOPe 2.07: d3bn3a_
  • Chain 'B':
    Compound: Intercellular adhesion molecule 5
    Species: Homo sapiens [TaxId:9606]
    Gene: ICAM5, TLCN, TLN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bn3b1, d3bn3b2
  • Heterogens: MG, NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bn3A (A:)
    mnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhsqtkesqetlhkfaskpasefvkildtgeklkdlftelqkkiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bn3B (B:)
    epfwadlqprvafverggslwlncstncprperggletslrrngtqrglrwlarqlvdir
    epetqpvcffrcarrtlqarglirtfqrpdrvelmplppwqpvgenftlscrvpgagpra
    sltltllrgaqelirrsfagepprargavltatvlarredhganfscraeldlrphglgl
    fenssaprelrtfsls