PDB entry 3bn0

View 3bn0 on RCSB PDB site
Description: The ribosomal protein S16 from Aquifex aeolicus
Class: ribosome
Keywords: ribosomal protein, Ribonucleoprotein, RIBOSOME
Deposited on 2007-12-13, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S16
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: rpsP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bn0a1
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bn0A (A:)
    mavrirlakfgrkhhpiyrivvmdakspregkyidilgtydpkrkvlinvypekvkewvl
    kgvelshrakailwnhgilkevvpegyemkrvgdyyvfekreskkskggeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bn0A (A:)
    avrirlakfgrkhhpiyrivvmdakyidilgtydpkrkvlinvypekvkewvlkgvelsh
    rakailwnhgilkevvpegyemkrvgdyyvfekre