PDB entry 3bm9

View 3bm9 on RCSB PDB site
Description: Discovery of Benzisoxazoles as Potent Inhibitors of Chaperone Hsp90
Class: Chaperone
Keywords: Chaperone, ATP binding domain, Alternative splicing, ATP-binding, Cytoplasm, Nucleotide-binding, Phosphoprotein, Stress response
Deposited on 2007-12-12, released 2008-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.165
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: HOMO SAPIENS
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bm9a_
  • Heterogens: BXZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bm9A (A:)
    qpmeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskl
    dsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadism
    igqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhl
    kedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bm9A (A:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfve