PDB entry 3bkm

View 3bkm on RCSB PDB site
Description: Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
Class: immune system
Keywords: Abeta, amyloid beta peptide, Fab, WO2, alzheimer's disease, immunotherapies, APP, IMMUNE SYSTEM
Deposited on 2007-12-07, released 2008-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.205
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: WO2 IgG2a Fab fragment Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BKM (0-223)
    Domains in SCOPe 2.07: d3bkmh1
  • Chain 'L':
    Compound: WO2 IgG2a Fab fragment Light Chain Kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BKM
    Domains in SCOPe 2.07: d3bkml1, d3bkml2
  • Heterogens: NA, ZN, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bkmH (H:)
    vtlkesgpgllkpsqtlsltcsfsgfsirtskvgvswirqpsgkglewlahiywdddkry
    npslesrltiskdtsrdmvfmkitsvdtadtatyycarrgfygrkyevnhfdywgqgttl
    tvssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpav
    lqsdlytlsssvtvtsstwpsesitcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3bkmL (L:)
    dqspqavssgcllkmklpvrllvlmfwipgsssdvlmtqtplslpvnlgeqasiscrssq
    sivhsnghtylewylqrpgqspklliyqvstrfsgvpdrfsgsgsgtdftlrisrveaed
    lgvyycfqaslvpltfgagtklelkradaaptvsifppsseqltsggasvvcflnnfypk
    dinvkwkidgserqngvlnswtdqdskdstysmsstltltkdeyerhnsytceathktst
    spivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bkmL (L:)
    dvlmtqtplslpvnlgeqasiscrssqsivhsnghtylewylqrpgqspklliyqvstrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqaslvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne