PDB entry 3bkj

View 3bkj on RCSB PDB site
Description: Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
Class: immune system
Keywords: Abeta, amyloid beta peptide, Fab, WO2, alzheimer's disease, immunotherapies, APP, IMMUNE SYSTEM
Deposited on 2007-12-06, released 2008-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid Beta Peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3BKJ
  • Chain 'H':
    Compound: WO2 IgG2a Fab fragment Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BKJ (0-223)
    Domains in SCOPe 2.07: d3bkjh1
  • Chain 'L':
    Compound: WO2 IgG2a Fab fragment Light Chain Kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BKJ
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bkjH (H:)
    vtlkesgpgllkpsqtlsltcsfsgfsirtskvgvswirqpsgkglewlahiywdddkry
    npslesrltiskdtsrdmvfmkitsvdtadtatyycarrgfygrkyevnhfdywgqgttl
    tvssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpav
    lqsdlytlsssvtvtsstwpsesitcnvahpasstkvdkkivpr
    

  • Chain 'L':
    No sequence available.