PDB entry 3bkc

View 3bkc on RCSB PDB site
Description: Crystal structure of anti-amyloid beta FAB WO2 (P21, FormB)
Class: immune system
Keywords: Abeta, amyloid beta peptide, Fab, WO2, alzheimer's disease, immunotherapies, APP, IMMUNE SYSTEM
Deposited on 2007-12-06, released 2008-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: WO2 IgG2a Fab fragment Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BKC
    Domains in SCOPe 2.06: d3bkch1
  • Chain 'L':
    Compound: WO2 IgG2a Fab fragment Light Chain Kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BKC
    Domains in SCOPe 2.06: d3bkcl1, d3bkcl2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3bkcH (H:)
    evtlkesgpgllkpsqtlsltcsfsgfsirtskvgvswirqpsgkglewlahiywdddkr
    ynpslesrltiskdtsrdmvfmkitsvdtadtatyycarrgfygrkyevnhfdywgqgtt
    ltvssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpa
    vlqsdlytlsssvtvtsstwpsesitcnvahpasstkvdkkivprdcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bkcH (H:)
    vtlkesgpgllkpsqtlsltcsfsgfsirtskvgvswirqpsgkglewlahiywdddkry
    npslesrltiskdtsrdmvfmkitsvdtadtatyycarrgfygrkyevnhfdywgqgttl
    tvssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpav
    lqsdlytlsssvtvtsstwpsesitcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3bkcL (L:)
    dqspqavssgcllkmklpvrllvlmfwipgsssdvlmtqtplslpvnlgeqasiscrssq
    sivhsnghtylewylqrpgqspklliyqvstrfsgvpdrfsgsgsgtdftlrisrveaed
    lgvyycfqaslvpltfgagtklelkradaaptvsifppsseqltsggasvvcflnnfypk
    dinvkwkidgserqngvlnswtdqdskdstysmsstltltkdeyerhnsytceathktst
    spivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bkcL (L:)
    dvlmtqtplslpvnlgeqasiscrssqsivhsnghtylewylqrpgqspklliyqvstrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqaslvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne