PDB entry 3bja

View 3bja on RCSB PDB site
Description: Crystal structure of putative MarR-like transcription regulator (NP_978771.1) from Bacillus cereus ATCC 10987 at 2.38 A resolution
Class: transcription regulator
Keywords: NP_978771.1, Putative MarR-like Transcription Regulator, MarR family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, DNA-binding, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2007-12-03, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, MarR family, putative
    Species: Bacillus cereus [TaxId:222523]
    Gene: NP_978771.1, BCE_2462
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q738D3 (1-138)
      • leader sequence (0)
    Domains in SCOPe 2.07: d3bjaa1, d3bjaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bjaA (A:)
    gmnnrelygnirdvyhllqknldkaieqydisyvqfgviqvlaksgkvsmsklienmgcv
    psnmttmiqrmkrdgyvmteknpndqretlvyltkkgeetkkqvdvqysdflkencgcft
    keeegiledlllkwkkhln