PDB entry 3bj9

View 3bj9 on RCSB PDB site
Description: Crystal structure of the Surrogate Light Chain Variable Domain VpreBJ
Class: immune system
Keywords: immunoglobulin domain, beta sheet, Polymorphism, IMMUNE SYSTEM
Deposited on 2007-12-03, released 2008-03-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Immunoglobulin iota chain, Immunoglobulin lambda-like polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: VPREB1, VPREB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12018 (0-99)
      • see remark 999 (100-104)
      • see remark 999 (106-113)
      • expression tag (114-115)
    Domains in SCOPe 2.05: d3bj91_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bj91 (1:)
    vlhqppamssalgttirltctlrndhdigvysvywyqqrpghpprfllryfsqsdksqgp
    qvpprfsgskdvarnrgylsiselqpedeamyycamgarsthvfgsgtqltvlsaa