PDB entry 3bhx

View 3bhx on RCSB PDB site
Description: X-ray structure of human glutamate carboxypeptidase II (GCPII) in complex with a transition state analog of Asp-Glu
Class: hydrolase
Keywords: prostate specific membrane antigen, metallopeptidase, folate hydrolase, glutamate carboxypeptidase II, Naaladase, Dipeptidase, Glycoprotein, Metal-binding, Metalloprotease, Multifunctional enzyme, Protease, Signal-anchor, Transmembrane, HYDROLASE
Deposited on 2007-11-29, released 2008-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bhxa1, d3bhxa2, d3bhxa3
  • Heterogens: NAG, ZN, CA, CL, BHX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bhxA (A:)
    rskssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwk
    efgldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppf
    safspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlag
    akgvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrr
    giaeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqk
    vkmhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrs
    fgtlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnyt
    lrvdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndf
    evffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrg
    gmvfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfte
    iaskfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkya
    gesfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bhxA (A:)
    khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
    vllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdl
    vyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpady
    fapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipv
    hpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtr
    iynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprr
    tilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslv
    hnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgr
    arytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlp
    fdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfs
    npivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdie
    skvdpskawgevkrqiyvaaftvqaaaetlseva