PDB entry 3bhu

View 3bhu on RCSB PDB site
Description: Structure of phosphorylated Thr160 CDK2/cyclin A in complex with the inhibitor meriolin 5
Class: transferase
Keywords: Ser/Thr protein kinase, transferase, phosphorylation, cell cycle, ATP-binding, Cell division, Mitosis, Nucleotide-binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Cyclin
Deposited on 2007-11-29, released 2008-02-12
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-12, with a file datestamp of 2008-02-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: HOMO SAPIENS
    Gene: CDK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (2-299)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Cyclin-A2
    Species: BOS TAURUS
    Gene: CCNA2, CCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bhub1, d3bhub2
  • Chain 'C':
    Compound: Cell division protein kinase 2
    Species: HOMO SAPIENS
    Gene: CDK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (2-End)
      • expression tag (0-1)
  • Chain 'D':
    Compound: Cyclin-A2
    Species: BOS TAURUS
    Gene: CCNA2, CCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bhud1, d3bhud2
  • Heterogens: MG, MHR, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bhuB (B:)
svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
vlrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylky
lpsviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsir
ekyknskyhgvsllnppetlnv

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bhuD (D:)
svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
vlrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylky
lpsviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsir
ekyknskyhgvsllnppetlnv