PDB entry 3bh7

View 3bh7 on RCSB PDB site
Description: Crystal structure of the RP2-Arl3 complex bound to GDP-AlF4
Class: signaling protein
Keywords: Protein-Protein complex, GTPase Activating protein and GTPase, Retinitis pigmentosa, GTP-binding, Lipoprotein, Myristate, Nucleotide-binding, Disease mutation, Membrane, Palmitate, Phosphoprotein, Sensory transduction, Vision, METAL BINDING PROTEIN, SIGNALING PROTEIN
Deposited on 2007-11-28, released 2008-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.233
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: ARL3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bh7a_
  • Chain 'B':
    Compound: Protein XRP2
    Species: Homo sapiens [TaxId:9606]
    Gene: RP2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, ALF, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bh7A (A:)
    ggsevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvwdiggqrk
    irpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifankqdllta
    apaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bh7A (A:)
    evrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvwdiggqrkirp
    ywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifankqdlltaapa
    seiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv
    

  • Chain 'B':
    No sequence available.