PDB entry 3bfk

View 3bfk on RCSB PDB site
Description: Crystal structure of Plasmodium falciparum Rab11a in complex with GDP
Class: hydrolase
Keywords: Malaria, Rab, GTPase, Structural Genomics Consortium, SGC, GTP-binding, Nucleotide-binding, HYDROLASE
Deposited on 2007-11-21, released 2007-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small GTPase Rab11
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bfka_
  • Chain 'B':
    Compound: Small GTPase Rab11
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bfkb_
  • Chain 'C':
    Compound: Small GTPase Rab11
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bfkc_
  • Chain 'D':
    Compound: Small GTPase Rab11
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bfkd_
  • Chain 'E':
    Compound: Small GTPase Rab11
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bfke_
  • Heterogens: GDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bfkA (A:)
    gdyydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaq
    iwdtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvg
    nksdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynvrqkkqatk
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bfkA (A:)
    dyydylfkivligdsgvgksnllsrftrdefnlgvefatksiqlnnkiikaqiwdtaits
    ayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnksdlkhlrvindnd
    atqyakkeklafietsaleatnvelafhqllneiynvrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bfkB (B:)
    gdyydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaq
    iwdtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvg
    nksdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynvrqkkqatk
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bfkB (B:)
    yydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaqiw
    dtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnk
    sdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynvrqkkqatkn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bfkC (C:)
    gdyydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaq
    iwdtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvg
    nksdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynvrqkkqatk
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bfkC (C:)
    yydylfkivligdsgvgksnllsrftrdefnleskgvefatksiqlknnkiikaqiwdta
    gaitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnksdlkhlrv
    indndatqyakkeklafietsaleatnvelafhqllneiynvrqkkqatkn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bfkD (D:)
    gdyydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaq
    iwdtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvg
    nksdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynvrqkkqatk
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bfkD (D:)
    dyydylfkivligdsgvgksnllsrftrdefnlgvefatksiqlnkiikaqiwdtaaits
    ayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnksdlkhlrvindnd
    atqyakkeklafietsaleatnvelafhqllneiynvrq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bfkE (E:)
    gdyydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaq
    iwdtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvg
    nksdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynvrqkkqatk
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bfkE (E:)
    dyydylfkivligdsgvgksnllsrftrdefnlgvefatksiqlkiikaqiwdtaraits
    ayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnksdlkhlrvindnd
    atqyakkeklafietsaleatnvelafhqllneiynv