PDB entry 3bfh
View 3bfh on RCSB PDB site
Description: Crystal structure of a pheromone binding protein from Apis mellifera in complex with hexadecanoic acid
Class: pheromone binding protein
Keywords: Honeybee, Apis mellifera, pheromone binding protein, signal transduction, queen mandibular pheromone, hexadecanoic acid, PHEROMONE-BINDING PROTEIN
Deposited on
2007-11-21, released
2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pheromone-binding protein ASP1
Species: Apis mellifera
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3bfha_ - Heterogens: CL, PLM, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3bfhA (A:)
apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
Sequence, based on observed residues (ATOM records): (download)
>3bfhA (A:)
wvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvddea
nvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi