PDB entry 3bej

View 3bej on RCSB PDB site
Description: Structure of human FXR in complex with MFA-1 and co-activator peptide
Class: transcription regulator
Keywords: FXR, BAR, NR1H4, bile acid receptor, NHR, nuclear receptor, Activator, Alternative splicing, DNA-binding, Metal-binding, Nucleus, Repressor, Transcription, Transcription regulation, Zinc, Zinc-finger, Acyltransferase, Chromosomal rearrangement, Phosphoprotein, Polymorphism, Proto-oncogene, Transferase, Ubl conjugation, transcription/transferase COMPLEX, TRANSCRIPTION REGULATOR
Deposited on 2007-11-19, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile acid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H4, BAR, FXR, HRR1, RIP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3beja_
  • Chain 'B':
    Compound: Bile acid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H4, BAR, FXR, HRR1, RIP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bejb_
  • Chain 'E':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA1, SRC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA1, SRC1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: YT3, MUF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bejA (A:)
    ttkscrekteltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnh
    vqvlveftkklpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirn
    sgisdeyitpmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldv
    lqklckihqpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bejA (A:)
    ltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftkk
    lpgfqtldhedqiallkgsaveamflrsaeifnkkghsdlleerirnsgisdeyitpmfs
    fyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihqpenp
    qhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bejB (B:)
    ttkscrekteltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnh
    vqvlveftkklpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirn
    sgisdeyitpmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldv
    lqklckihqpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bejB (B:)
    eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
    klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
    pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
    penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.