PDB entry 3beg

View 3beg on RCSB PDB site
Description: Crystal structure of SR protein kinase 1 complexed to its substrate ASF/SF2
Class: Transferase/Splicing
Keywords: kinase, sr protein kinase, sr protein, pre-mRNA splicing, ATP-binding, Chromosome partition, Differentiation, mRNA processing, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Methylation, RNA-binding, Spliceosome, Transferase-Splicing COMPLEX
Deposited on 2007-11-18, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.24
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase SRPK1
    Species: Homo sapiens [TaxId:9606]
    Gene: SRPK1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Splicing factor, arginine/serine-rich 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SFRS1, ASF, SF2, SF2P33
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3begb_
  • Heterogens: SEP, ANP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3begB (B:)
    ggaprgrygppsrrsenrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvr
    kedmtyavrkldntkfrshegetayirvkvdgprspsygrsrsrsrsrsrsrsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3begB (B:)
    nrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrkedmtyavrkldntkf
    rshegetayirvkvdgsygrsrsrsr