PDB entry 3beg

View 3beg on RCSB PDB site
Description: Crystal structure of SR protein kinase 1 complexed to its substrate ASF/SF2
Class: Transferase/Splicing
Keywords: kinase, sr protein kinase, sr protein, pre-mRNA splicing, ATP-binding, Chromosome partition, Differentiation, mRNA processing, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Methylation, RNA-binding, Spliceosome, Transferase-Splicing COMPLEX
Deposited on 2007-11-18, released 2008-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Serine/threonine-protein kinase SRPK1
  Species: Homo sapiens [TaxId:9606]
  Gene: SRPK1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96SB4
  • Uniprot Q96SB4 (Start-380)
• Chain 'B':
  Compound: Splicing factor, arginine/serine-rich 1
  Species: Homo sapiens [TaxId:9606]
  Gene: SFRS1, ASF, SF2, SF2P33
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07955
  Domains in SCOPe 2.08: d3begb_
• Heterogens: SEP, ALA, ANP

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3begB (B:)
  ggaprgrygppsrrsenrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvr
  kedmtyavrkldntkfrshegetayirvkvdgprspsygrsrsrsrsrsrsrsrs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3begB (B:)
  nrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrkedmtyavrkldntkf
  rshegetayirvkvdgsygrsrsrsr