PDB entry 3bdw

View 3bdw on RCSB PDB site
Description: Human CD94/NKG2A
Class: immune system receptor
Keywords: NK cells, receptor, Glycoprotein, Lectin, Membrane, Signal-anchor, Transmembrane, IMMUNE SYSTEM RECEPTOR
Deposited on 2007-11-15, released 2008-01-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Natural killer cells antigen CD94
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRD1, CD94
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3bdwa_
  • Chain 'B':
    Compound: NKG2-A/NKG2-B type II integral membrane protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRC1, NKG2A
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Natural killer cells antigen CD94
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRD1, CD94
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3bdwc_
  • Chain 'D':
    Compound: NKG2-A/NKG2-B type II integral membrane protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRC1, NKG2A
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdwA (A:)
    dccscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfyw
    iglsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickq
    qli
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bdwC (C:)
    dccscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfyw
    iglsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickq
    qli
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdwC (C:)
    ccscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfywi
    glsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickqq
    li
    

  • Chain 'D':
    No sequence available.