PDB entry 3bdm

View 3bdm on RCSB PDB site
Description: yeast 20S proteasome:glidobactin A-complex
Class: Hydrolase
Keywords: proteasome, ubiquitin, proteolysis, pathogen, virulence factor, Cytoplasm, Hydrolase, Nucleus, Protease, Threonine protease, Ubl conjugation, Phosphoprotein, Zymogen
Deposited on 2007-11-15, released 2008-04-08
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-15, with a file datestamp of 2008-04-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.234
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: Proteasome component PRE4
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdm01
  • Chain '1':
    Compound: Proteasome component PRE3
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdm11
  • Chain 'A':
    Compound: Proteasome component Y7
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdma1
  • Chain 'B':
    Compound: Proteasome component Y13
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmb1
  • Chain 'C':
    Compound: Proteasome component PRE6
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmc1
  • Chain 'D':
    Compound: Proteasome component PUP2
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Proteasome component PRE5
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdme1
  • Chain 'F':
    Compound: Proteasome component C1
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmf1
  • Chain 'G':
    Compound: Proteasome component C7-alpha
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmg1
  • Chain 'H':
    Compound: Proteasome component PUP1
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmh1
  • Chain 'I':
    Compound: Proteasome component PUP3
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmi1
  • Chain 'J':
    Compound: Proteasome component C11
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmj1
  • Chain 'K':
    Compound: Proteasome component PRE2
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmk1
  • Chain 'L':
    Compound: Proteasome component C5
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdml1
  • Chain 'M':
    Compound: Proteasome component PRE4
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmm1
  • Chain 'N':
    Compound: Proteasome component PRE3
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmn1
  • Chain 'O':
    Compound: Proteasome component Y7
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmo1
  • Chain 'P':
    Compound: Proteasome component Y13
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmp1
  • Chain 'Q':
    Compound: Proteasome component PRE6
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmq1
  • Chain 'R':
    Compound: Proteasome component PUP2
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Proteasome component PRE5
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdms1
  • Chain 'T':
    Compound: Proteasome component C1
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmt1
  • Chain 'U':
    Compound: Proteasome component C7-alpha
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmu1
  • Chain 'V':
    Compound: Proteasome component PUP1
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmv1
  • Chain 'W':
    Compound: Proteasome component PUP3
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmw1
  • Chain 'X':
    Compound: Proteasome component C11
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmx1
  • Chain 'Y':
    Compound: Proteasome component PRE2
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmy1
  • Chain 'Z':
    Compound: Proteasome component C5
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdmz1
  • Heterogens: GDT, HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >3bdm0 (0:)
    mnhdpfswgrpadstygayntqianagaspmvntqqpivtgtsvismkydngviiaadnl
    gsygsllrfngverlipvgdntvvgisgdisdmqhierllkdlvtenaydnpladaeeal
    epsyifeylatvmyqrrskmnplwnaiivagvqsngdqflryvnllgvtyssptlatgfg
    ahmanpllrkvvdresdipkttvqvaeeaivnamrvlyyrdarssrnfslaiidkntglt
    fkknlqvenmkwdfakdikgygtqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdm0 (0:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdm1 (1:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdmA (A:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bdmB (B:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmB (B:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bdmC (C:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmC (C:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bdmE (E:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmE (E:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3bdmF (F:)
    tsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvp
    qknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvq
    ahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvd
    hhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaid
    faqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmF (F:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3bdmG (G:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmG (G:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3bdmH (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmH (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3bdmI (I:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmI (I:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdmJ (J:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdmK (K:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3bdmL (L:)
    matiaseysseasntpiehqfnpygdnggtilgiagedfavlagdtrnitdysinsryep
    kvfdcgdnivmsangfaadgdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkr
    ffpyyvhtiiagldedgkgavysfdpvgsyereqcraggaaaslimpfldnqvnfknqye
    pgtngkvkkplkylsveeviklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkr
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmL (L:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3bdmM (M:)
    mnhdpfswgrpadstygayntqianagaspmvntqqpivtgtsvismkydngviiaadnl
    gsygsllrfngverlipvgdntvvgisgdisdmqhierllkdlvtenaydnpladaeeal
    epsyifeylatvmyqrrskmnplwnaiivagvqsngdqflryvnllgvtyssptlatgfg
    ahmanpllrkvvdresdipkttvqvaeeaivnamrvlyyrdarssrnfslaiidkntglt
    fkknlqvenmkwdfakdikgygtqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmM (M:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdmN (N:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdmO (O:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3bdmP (P:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmP (P:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3bdmQ (Q:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmQ (Q:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3bdmS (S:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmS (S:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3bdmT (T:)
    tsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvp
    qknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvq
    ahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvd
    hhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaid
    faqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmT (T:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3bdmU (U:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmU (U:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3bdmV (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmV (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3bdmW (W:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmW (W:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdmX (X:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdmY (Y:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3bdmZ (Z:)
    matiaseysseasntpiehqfnpygdnggtilgiagedfavlagdtrnitdysinsryep
    kvfdcgdnivmsangfaadgdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkr
    ffpyyvhtiiagldedgkgavysfdpvgsyereqcraggaaaslimpfldnqvnfknqye
    pgtngkvkkplkylsveeviklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkr
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdmZ (Z:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd