PDB entry 3bdi

View 3bdi on RCSB PDB site
Description: Crystal structure of predicted CIB-like hydrolase (NP_393672.1) from Thermoplasma acidophilum at 1.45 A resolution
Class: hydrolase
Keywords: NP_393672.1, predicted CIB-like hydrolase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, HYDROLASE
Deposited on 2007-11-14, released 2007-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.164
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein Ta0194
    Species: Thermoplasma acidophilum DSM 1728 [TaxId:273075]
    Gene: NP_393672.1, Ta0194
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HLN3 (11-206)
      • leader sequence (0)
      • variant (1-10)
      • see remark 999 (190)
    Domains in SCOPe 2.06: d3bdia1, d3bdia2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdiA (A:)
    gmalqeefidvngtrvfqrkmvtdsnrrsialfhgysftsmdwdkadlfnnyskigynvy
    apdypgfgrsassekygidrgdlkhaaefirdylkangvarsvimgasmgggmvimttlq
    ypdivdgiiavapawveslkgdmkkirqktllvwgskdhvvpialskeyasiisgsrlei
    vegsghpvyiekpeefvritvdflrnl