PDB entry 3bd5

View 3bd5 on RCSB PDB site
Description: Crystal structure of single domain VL of an anti-DNA binding antibody 3D8 scFv and its active site revealed by complex structures of a small molecule and metals
Class: immune system
Keywords: beta sandwich, metal complex, IMMUNE SYSTEM
Deposited on 2007-11-14, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalytic antibody
    Species: Mus musculus [TaxId:10090]
    Gene: 3d8 vl
    Database cross-references and differences (RAF-indexed):
    • PDB 3BD5 (0-111)
    Domains in SCOPe 2.06: d3bd5a_
  • Chain 'B':
    Compound: catalytic antibody
    Species: Mus musculus [TaxId:10090]
    Gene: 3d8 vl
    Database cross-references and differences (RAF-indexed):
    • PDB 3BD5 (0-111)
    Domains in SCOPe 2.06: d3bd5b_
  • Heterogens: CO, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bd5A (A:)
lvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleik

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bd5B (B:)
lvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleik