PDB entry 3bcq

View 3bcq on RCSB PDB site
Description: Crystal structure of oxy-hemoglobin from Brycon cephalus
Class: transport protein/oxygen binding
Keywords: hemoglobin, fish, brycon cephalus, Heme, Iron, Metal-binding, Oxygen transport, Transport, TRANSPORT PROTEIN/OXYGEN BINDING COMPLEX
Deposited on 2007-11-13, released 2008-10-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.172
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-chain hemoglobin
    Species: Brycon cephalus [TaxId:126311]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1YZP4 (0-141)
      • see remark 999 (8)
      • see remark 999 (31)
      • see remark 999 (64-65)
      • see remark 999 (111)
      • see remark 999 (131)
      • see remark 999 (133-135)
    Domains in SCOPe 2.01: d3bcqa_
  • Chain 'B':
    Compound: Beta-chain hemoglobin
    Species: Brycon cephalus [TaxId:126311]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BCQ (0-145)
    Domains in SCOPe 2.01: d3bcqb_
  • Chain 'C':
    Compound: Alpha-chain hemoglobin
    Species: Brycon cephalus [TaxId:126311]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1YZP4 (0-141)
      • see remark 999 (8)
      • see remark 999 (31)
      • see remark 999 (64-65)
      • see remark 999 (111)
      • see remark 999 (131)
      • see remark 999 (133-135)
    Domains in SCOPe 2.01: d3bcqc_
  • Chain 'D':
    Compound: Beta-chain hemoglobin
    Species: Brycon cephalus [TaxId:126311]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BCQ (0-145)
    Domains in SCOPe 2.01: d3bcqd_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bcqA (A:)
slsdkdkdsikafwakispkaedigadalarmltvypqtktyfshwkdlspgsapvkkhg
ktvmgsvaeavskiddltnglltlselhafqlrvdpanfkilshnllvvlaqqfpndftp
evhvsmdkflsllswslsekyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bcqB (B:)
vewstaersaiaglwgkisvdeigpqalsrllivypwtqrhfaafgnlsspaaingnpkv
ahhgkvvmggleraiknmdnikaaysslsvmhseklhvdpdnfrlladcitvcvamkfgp
saftpdvqeawqkflavvvaalsryh

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bcqC (C:)
slsdkdkdsikafwakispkaedigadalarmltvypqtktyfshwkdlspgsapvkkhg
ktvmgsvaeavskiddltnglltlselhafqlrvdpanfkilshnllvvlaqqfpndftp
evhvsmdkflsllswslsekyr

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bcqD (D:)
vewstaersaiaglwgkisvdeigpqalsrllivypwtqrhfaafgnlsspaaingnpkv
ahhgkvvmggleraiknmdnikaaysslsvmhseklhvdpdnfrlladcitvcvamkfgp
saftpdvqeawqkflavvvaalsryh