PDB entry 3bbu

View 3bbu on RCSB PDB site
Description: The Hsp15 protein fitted into the low resolution Cryo-EM map of the 50S.nc-tRNA.Hsp15 complex
Class: ribosome
Keywords: Alpha-L RNA binding, heat shock, rescue stalled ribosome, RIBOSOME
Deposited on 2007-11-11, released 2008-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: EM
Resolution: 10 Å
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Heat Shock Protein 15
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ACG8 (0-103)
  Domains in SCOPe 2.07: d3bbua1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bbuA (A:)
  pavevrldkwlwaarfyktralaremieggkvhyngqrskpskivelnatltlrqgnder
  tvivkaiteqrrpaseaallyeetaesvekrekmalarklnalt