PDB entry 3bbs

View 3bbs on RCSB PDB site
Description: The carbohydrate recognition domain of Langerin reveals high structural similarity with the one of DC-SIGN but an additional, calcium-independent sugar-binding site
Class: immune system
Keywords: calcium-binding, CRD, DC-SIGN, Langerin, lectin, maltose binding, Glycoprotein, Long loop region, Membrane protein, Sugar-binding, Transmembrane protein, IMMUNE SYSTEM, CARBOHYDRATE BINDING PROTEIN
Deposited on 2007-11-11, released 2007-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: langerin
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71 (0-128)
      • see remark 999 (81)
    Domains in SCOPe 2.07: d3bbsa_
  • Chain 'B':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: langerin
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71 (0-128)
      • see remark 999 (81)
    Domains in SCOPe 2.07: d3bbsb_
  • Chain 'C':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: langerin
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71 (Start-128)
      • see remark 999 (81)
    Domains in SCOPe 2.07: d3bbsc_
  • Chain 'D':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: langerin
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71 (0-128)
      • see remark 999 (81)
    Domains in SCOPe 2.07: d3bbsd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbsA (A:)
    qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
    kagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktfl
    fickrpyvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbsB (B:)
    qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
    kagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktfl
    fickrpyvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bbsC (C:)
    qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
    kagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktfl
    fickrpyvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bbsC (C:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
    agmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktflf
    ickrpyvp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbsD (D:)
    qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
    kagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktfl
    fickrpyvp