PDB entry 3bb4

View 3bb4 on RCSB PDB site
Description: Crystal structure of Toc33 from Arabidopsis thaliana in complex with Mg2+ and GMPPNP
Class: hydrolase
Keywords: Rossman fold, GTPase domain, chloroplast import, HYDROLASE
Deposited on 2007-11-09, released 2008-04-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.221
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T7I23.11 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: T7I23.11
    Database cross-references and differences (RAF-indexed):
    • Uniprot O23680
      • engineered (180)
    Domains in SCOPe 2.04: d3bb4a_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bb4A (A:)
    mgslvrewvgfqqfpaatqeklieffgklkqkdmnsmtvlvlgkggvgksstvnsligeq
    vvrvspfqaeglrpvmvsrtmggftiniidtpglveagyvnhqalelikgflvnrtidvl
    lyvdrldvyrvdeldkqvviaitqtfgkeiwcktllvlthaqfsppdelsyetfsskrsd
    ellktiragskmrkqefedsaiavvyaensgrcskndkdekalpngeawipnlvkaitdv
    atnqrkaihvdaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bb4A (A:)
    ewvgfqqfpaatqeklieffgklkqkdmnsmtvlvlgkggvgksstvnsligeqvvrvsp
    flrpvmvsrtmggftiniidtpglveagyvnhqalelikgflvnrtidvllyvdrldvyr
    vdeldkqvviaitqtfgkeiwcktllvlthaqfsppdelsyetfsskrsdellktirags
    kmrkqefedsaiavvyaensgrcskndkdekalpngeawipnlvkaitdvatnqrkaihv