PDB entry 3bb1

View 3bb1 on RCSB PDB site
Description: Crystal structure of Toc34 from Pisum sativum in complex with Mg2+ and GMPPNP
Class: hydrolase
Keywords: Rossmann fold, GTPase domain, chloroplast import, GTP-binding, Hydrolase, Membrane, Nucleotide-binding, Outer membrane, Protein transport, Transmembrane, Transport
Deposited on 2007-11-09, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translocase of chloroplast 34
    Species: Pisum sativum [TaxId:3888]
    Gene: TOC34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009
      • engineered (9)
    Domains in SCOPe 2.06: d3bb1a_
  • Chain 'B':
    Compound: Translocase of chloroplast 34
    Species: Pisum sativum [TaxId:3888]
    Gene: TOC34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009
      • engineered (9)
    Domains in SCOPe 2.06: d3bb1b_
  • Chain 'C':
    Compound: Translocase of chloroplast 34
    Species: Pisum sativum [TaxId:3888]
    Gene: TOC34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009
      • engineered (9)
    Domains in SCOPe 2.06: d3bb1c_
  • Chain 'D':
    Compound: Translocase of chloroplast 34
    Species: Pisum sativum [TaxId:3888]
    Gene: TOC34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009
      • engineered (9)
    Domains in SCOPe 2.06: d3bb1d_
  • Chain 'E':
    Compound: Translocase of chloroplast 34
    Species: Pisum sativum [TaxId:3888]
    Gene: TOC34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009
      • engineered (9)
    Domains in SCOPe 2.06: d3bb1e_
  • Chain 'F':
    Compound: Translocase of chloroplast 34
    Species: Pisum sativum [TaxId:3888]
    Gene: TOC34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009
      • engineered (9)
    Domains in SCOPe 2.06: d3bb1f_
  • Chain 'G':
    Compound: Translocase of chloroplast 34
    Species: Pisum sativum [TaxId:3888]
    Gene: TOC34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009
      • engineered (9)
    Domains in SCOPe 2.06: d3bb1g_
  • Chain 'H':
    Compound: Translocase of chloroplast 34
    Species: Pisum sativum [TaxId:3888]
    Gene: TOC34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009
      • engineered (9)
    Domains in SCOPe 2.06: d3bb1h_
  • Heterogens: MG, GNP, PGE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bb1A (A:)
    masqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidgpnpnqrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bb1A (A:)
    asqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiig
    ervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktid
    vllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskr
    seallqvvrsgaslksdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnk
    sesifvdknlid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bb1B (B:)
    masqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidgpnpnqrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bb1B (B:)
    vrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvsi
    spfqsgprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyvdr
    ldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseallqv
    vrsgaslasdipvvliensgrcnsdekvlpngiawiphlvqtitevalnksesifvdknl
    idg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bb1C (C:)
    masqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidgpnpnqrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bb1C (C:)
    vrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvsi
    spfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyvd
    rldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseallq
    vvrsgaslksdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnksesifv
    dknlid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bb1D (D:)
    masqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidgpnpnqrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bb1D (D:)
    tvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvs
    ispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyv
    drldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseall
    qvvrsgaslkkdaasdipvvliensgrcndekvlpngiawiphlvqtitevalnksesif
    vdknlid
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bb1E (E:)
    masqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidgpnpnqrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bb1E (E:)
    vrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvsi
    spfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyvd
    rldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseallq
    vvrsgaslkkasdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnksesi
    fvdknlid
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3bb1F (F:)
    masqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidgpnpnqrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bb1F (F:)
    vrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvsi
    spfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyvd
    rldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseallq
    vvrsgaslkkdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnksesifv
    dknli
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3bb1G (G:)
    masqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidgpnpnqrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bb1G (G:)
    asqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiig
    ervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktid
    vllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskr
    seallqvvrsgaslsdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnks
    esifvdknlid
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3bb1H (H:)
    masqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidgpnpnqrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bb1H (H:)
    vrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvsi
    spfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyvd
    rldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseallq
    vvrsgaslkkdsdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnksesi
    fvdknlid