PDB entry 3b9v

View 3b9v on RCSB PDB site
Description: Crystal Structure of an Autonomous VH Domain
Class: immune system
Keywords: antibody engineering, phage display, IMMUNE SYSTEM
Deposited on 2007-11-06, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heavy chain variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B9V (0-End)
    Domains in SCOPe 2.07: d3b9va_
  • Chain 'B':
    Compound: heavy chain variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B9V (0-End)
    Domains in SCOPe 2.07: d3b9vb_
  • Chain 'C':
    Compound: heavy chain variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B9V (0-End)
    Domains in SCOPe 2.07: d3b9vc_
  • Chain 'D':
    Compound: heavy chain variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B9V (0-End)
    Domains in SCOPe 2.07: d3b9vd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b9vA (A:)
    evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry
    adsvkgrftisadtskntaylqmnslraedtavyycarwggdgfyamdywgqgtlvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9vA (A:)
    evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry
    adsvkgrftisadtskntaylqmnslraedtavyycarwggdgfyamdywgqgtlvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b9vB (B:)
    evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry
    adsvkgrftisadtskntaylqmnslraedtavyycarwggdgfyamdywgqgtlvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9vB (B:)
    evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry
    adsvkgrftisadtskntaylqmnslraedtavyycarwggyamdywgqgtlvtvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b9vC (C:)
    evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry
    adsvkgrftisadtskntaylqmnslraedtavyycarwggdgfyamdywgqgtlvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9vC (C:)
    evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry
    adsvkgrftisadtskntaylqmnslraedtavyycarwggdgfyamdywgqgtlvtvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b9vD (D:)
    evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry
    adsvkgrftisadtskntaylqmnslraedtavyycarwggdgfyamdywgqgtlvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9vD (D:)
    evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry
    adsvkgrftisadtskntaylqmnslraedtavyycarwggfyamdywgqgtlvtvs