PDB entry 3b9p

View 3b9p on RCSB PDB site
Description: Spastin
Class: hydrolase
Keywords: AAA ATPase, ATP-binding, Nucleotide-binding, HYDROLASE
Deposited on 2007-11-06, released 2008-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.245
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CG5977-PA, isoform A
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: spas
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b9pa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b9pA (A:)
    qklvqlildeiveggakvewtdiagqdvakqalqemvilpsvrpelftglrapakglllf
    gppgngktllaravatecsatflnisaasltskyvgdgeklvralfavarhmqpsiifid
    evdsllserssseheasrrlkteflvefdglpgnpdgdrivvlaatnrpqeldeaalrrf
    tkrvyvslpdeqtrelllnrllqkqgspldtealrrlakitdgysgsdltalakdaalep
    irelnveqvkcldisamraiteqdfhsslkrirrsvapqslnsyekwsqdygditik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9pA (A:)
    klvqlildeiveggakvewtdiagqdvakqalqemvilpsvrpelftglrapakglllfg
    ppgngktllaravatecsatflnisaasltskyvgdgeklvralfavarhmqpsiifide
    vdsllsereasrrlkteflvefdglprivvlaatnrpqeldeaalrrftkrvyvslpdeq
    trelllnrllqkqgspldtealrrlakitdgysgsdltalakdaalepirelnisamrai
    teqdfhsslkrirrsvapqslnsyekws