PDB entry 3b9c

View 3b9c on RCSB PDB site
Description: Crystal Structure of Human GRP CRD
Class: unknown function
Keywords: beta sandwich, unknown function
Deposited on 2007-11-05, released 2008-03-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.224
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hspc159
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3b9ca_
  • Chain 'B':
    Compound: hspc159
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3b9cb_
  • Chain 'C':
    Compound: hspc159
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3b9cc_
  • Chain 'D':
    Compound: hspc159
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3b9cd_
  • Heterogens: SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b9cA (A:)
    mghhhhhhmvpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielk
    avftdrqllrnscisgergeeqsaipyfpfipdqpfrveilceyprfrvfvdghqlfdfy
    hriqtlsaidtikingdlqitklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9cA (A:)
    pfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllr
    nscisgergeeqsaipyfpfipdqpfrveilceyprfrvfvdghqlfdfyhriqtlsaid
    tikingdlqitklg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b9cB (B:)
    mghhhhhhmvpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielk
    avftdrqllrnscisgergeeqsaipyfpfipdqpfrveilceyprfrvfvdghqlfdfy
    hriqtlsaidtikingdlqitklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9cB (B:)
    pfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllr
    nscisgergeeqsaipyfpfipdqpfrveilceyprfrvfvdghqlfdfyhriqtlsaid
    tikingdlqitklg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b9cC (C:)
    mghhhhhhmvpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielk
    avftdrqllrnscisgergeeqsaipyfpfipdqpfrveilceyprfrvfvdghqlfdfy
    hriqtlsaidtikingdlqitklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9cC (C:)
    pfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllr
    nscisgergeeqsaipyfpfipdqpfrveilceyprfrvfvdghqlfdfyhriqtlsaid
    tikingdlqitklg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b9cD (D:)
    mghhhhhhmvpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielk
    avftdrqllrnscisgergeeqsaipyfpfipdqpfrveilceyprfrvfvdghqlfdfy
    hriqtlsaidtikingdlqitklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9cD (D:)
    pfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllr
    nscisgergeeqsaipyfpfipdqpfrveilceyprfrvfvdghqlfdfyhriqtlsaid
    tikingdlqitklg