PDB entry 3b97

View 3b97 on RCSB PDB site
Description: Crystal Structure of human Enolase 1
Class: lyase
Keywords: alpha/beta hydrolase, Acetylation, Alternative initiation, Cytoplasm, DNA-binding, Glycolysis, Lyase, Magnesium, Membrane, Metal-binding, Nucleus, Phosphorylation, Plasminogen activation, Polymorphism, Repressor, Transcription, Transcription regulation
Deposited on 2007-11-02, released 2008-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.184
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-enolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3b97a1, d3b97a2
  • Chain 'B':
    Compound: Alpha-enolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3b97b1, d3b97b2
  • Chain 'C':
    Compound: Alpha-enolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3b97c1, d3b97c2
  • Chain 'D':
    Compound: Alpha-enolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3b97d1, d3b97d2
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b97A (A:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnplak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b97A (A:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnpla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b97B (B:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnplak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b97B (B:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnpla
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b97C (C:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnplak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b97D (D:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnplak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b97D (D:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnpl