PDB entry 3b8z

View 3b8z on RCSB PDB site
Description: High Resolution Crystal Structure of the Catalytic Domain of ADAMTS-5 (Aggrecanase-2)
Class: hydrolase
Keywords: alpha/beta, HYDROLASE
Deposited on 2007-11-02, released 2007-12-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.187
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein ADAMTS-5
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAMTS5, ADAMTS11, ADMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNA0 (0-216)
      • engineered (18)
    Domains in SCOPe 2.01: d3b8za_
  • Chain 'B':
    Compound: protein ADAMTS-5
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAMTS5, ADAMTS11, ADMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNA0 (0-216)
      • engineered (18)
    Domains in SCOPe 2.01: d3b8zb_
  • Heterogens: ZN, CA, 294, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b8zA (A:)
    srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
    kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
    vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
    tsidaskpwskctsatiteflddghgnclldlprkqi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b8zB (B:)
    srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
    kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
    vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
    tsidaskpwskctsatiteflddghgnclldlprkqi