PDB entry 3b5n

View 3b5n on RCSB PDB site
Description: Structure of the yeast plasma membrane SNARE complex
Class: membrane protein
Keywords: SNARE complex, syntaxin, synaptobrevin, snap-25, Sso1p, Snc1p, Sec9p, Sec9, Sso1, Snc1, Coiled coil, Lipoprotein, Membrane, Palmitate, Transmembrane, Ubl conjugation, Phosphorylation, Protein transport, Transport, MEMBRANE PROTEIN
Deposited on 2007-10-26, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: synaptobrevin homolog 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31109 (1-60)
      • expression tag (0)
    Domains in SCOPe 2.07: d3b5na2, d3b5na3
  • Chain 'B':
    Compound: Protein SSO1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SSO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b5nb_
  • Chain 'C':
    Compound: Protein transport protein SEC9
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC9, HSS7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40357 (2-68)
      • expression tag (0-1)
      • expression tag (69)
    Domains in SCOPe 2.07: d3b5nc2, d3b5nc3, d3b5nc4
  • Chain 'D':
    Compound: Protein transport protein SEC9
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC9, HSS7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40357 (2-63)
      • expression tag (0-1)
  • Chain 'E':
    Compound: synaptobrevin homolog 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b5ne_
  • Chain 'F':
    Compound: Protein SSO1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SSO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b5nf_
  • Chain 'G':
    Compound: Protein transport protein SEC9
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC9, HSS7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40357 (2-68)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3b5ng1, d3b5ng2
  • Chain 'H':
    Compound: Protein transport protein SEC9
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC9, HSS7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40357 (2-63)
      • expression tag (1)
  • Chain 'I':
    Compound: synaptobrevin homolog 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b5ni_
  • Chain 'J':
    Compound: Protein SSO1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SSO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b5nj_
  • Chain 'K':
    Compound: Protein transport protein SEC9
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC9, HSS7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b5nk_
  • Chain 'L':
    Compound: Protein transport protein SEC9
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC9, HSS7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40357 (2-End)
      • expression tag (1)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b5nA (A:)
    gsrtaelqaeiddtvgimrdninkvaergerltsiedkadnlavsaqgfkrganrvrkam
    w
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b5nB (B:)
    alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
    tdkavksar
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b5nC (C:)
    gsikftkqssvastrntlkmaqdaeragmntlgmlghqseqlnnvegnldlmkvqnkvad
    ekvaelkklq
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3b5nE (E:)
    gsrtaelqaeiddtvgimrdninkvaergerltsiedkadnlavsaqgfkrganrvrkam
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b5nE (E:)
    taelqaeiddtvgimrdninkvaergerltsiedkadnlavsaqgfkrganrvrkamw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3b5nF (F:)
    alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
    tdkavksar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b5nF (F:)
    alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
    tdkavksa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3b5nG (G:)
    gsikftkqssvastrntlkmaqdaeragmntlgmlghqseqlnnvegnldlmkvqnkvad
    ekvaelkklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b5nG (G:)
    gsikftkqssvastrntlkmaqdaeragmntlgmlghqseqlnnvegnldlmkvqnkvad
    ekvaelkkl
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3b5nI (I:)
    gsrtaelqaeiddtvgimrdninkvaergerltsiedkadnlavsaqgfkrganrvrkam
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b5nI (I:)
    taelqaeiddtvgimrdninkvaergerltsiedkadnlavsaqgfkrganrvrkamw
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3b5nJ (J:)
    alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
    tdkavksar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b5nJ (J:)
    aevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvghtd
    kavk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3b5nK (K:)
    gsikftkqssvastrntlkmaqdaeragmntlgmlghqseqlnnvegnldlmkvqnkvad
    ekvaelkklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b5nK (K:)
    kftkqssvastrntlkmaqdaeragmntlgmlghqseqlnnvegnldlmkvqnkvadekv
    aelkk
    

  • Chain 'L':
    No sequence available.