PDB entry 3b5k

View 3b5k on RCSB PDB site
Description: Crystal structure of murine interleukin-5
Class: cytokine
Keywords: 4-helix bundle, Cytokine, Glycoprotein, Growth factor, Secreted
Deposited on 2007-10-26, released 2008-11-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-5
    Species: Mus musculus [TaxId:10090]
    Gene: Il5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04401
      • engineered (4)
      • engineered (28)
      • engineered (64)
      • engineered (104)
    Domains in SCOPe 2.04: d3b5ka_
  • Chain 'B':
    Compound: Interleukin-5
    Species: Mus musculus [TaxId:10090]
    Gene: Il5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04401
      • engineered (4)
      • engineered (28)
      • engineered (64)
      • engineered (104)
    Domains in SCOPe 2.04: d3b5kb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b5kA (A:)
    leiptstvvketltqlsahralltsnetlrlpvpthknhqlcigeifqgldilknqtvrg
    gtverlfqnlslikkyidrqkekcgeerrrtrqfldylqeflgvlstewaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b5kA (A:)
    tstvvketltqlsahralltsnetlrlpvpthknhqlcigeifqgldilknqtvrggtve
    rlfqnlslikkyidrqkekcgeerrrtrqfldylqeflgvlstew
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b5kB (B:)
    leiptstvvketltqlsahralltsnetlrlpvpthknhqlcigeifqgldilknqtvrg
    gtverlfqnlslikkyidrqkekcgeerrrtrqfldylqeflgvlstewaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b5kB (B:)
    iptstvvketltqlsahralltsnetlrlpvpthknhqlcigeifqgldilknqtvrggt
    verlfqnlslikkyidrqkekcgeerrrtrqfldylqeflgvlste