PDB entry 3b4y

View 3b4y on RCSB PDB site
Description: FGD1 (Rv0407) from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: TIM-barrel, non-prolyl cis-peptide bulge, F420 binding, Oxidoreductase, Structural Genomics, TB Structural Genomics Consortium, TBSGC
Deposited on 2007-10-25, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable f420-dependent glucose-6-phosphate dehydrogenase fgd1
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: Rv0407
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96253
      • engineered mutation (262)
    Domains in SCOPe 2.07: d3b4ya_
  • Chain 'B':
    Compound: probable f420-dependent glucose-6-phosphate dehydrogenase fgd1
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: Rv0407
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96253
      • engineered mutation (262)
    Domains in SCOPe 2.07: d3b4yb_
  • Heterogens: F42, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b4yA (A:)
    mgsshhhhhhssglvprgshmaelklgykasaeqfaprelvelavaaeahgmdsatvsdh
    fqpwrhqgghapfslswmtavgertnrlllgtsvltptfrynpaviaqafatmgclypnr
    vflgvgtgealneiatgyegawpefkerfarlresvglmrqlwsgdrvdfdgdyyrlkga
    siydvpdggvpvyiaaggpavakyagragdgfictsgkgeelyteklmpavregaaaadr
    svdgidkmieikisydpdpelamnntrfwaplsltaeqkhsiddpiemekaadalpieqi
    akrwivasdpdeavekvgqyvtwglnhlvfhapghdqrrflelfqsdlaprlrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4yA (A:)
    elklgykasaeqfaprelvelavaaeahgmdsatvsdhfqpwrhqgghapfslswmtavg
    ertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgealneiatgyegaw
    pefkerfarlresvglmrqlwsgdrvdfdgdyyrlkgasiydvpdggvpvyiaaggpava
    kyagragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmieikisydpdpela
    mnntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpdeavekvgqyvt
    wglnhlvfhapghdqrrflelfqsdlaprlrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b4yB (B:)
    mgsshhhhhhssglvprgshmaelklgykasaeqfaprelvelavaaeahgmdsatvsdh
    fqpwrhqgghapfslswmtavgertnrlllgtsvltptfrynpaviaqafatmgclypnr
    vflgvgtgealneiatgyegawpefkerfarlresvglmrqlwsgdrvdfdgdyyrlkga
    siydvpdggvpvyiaaggpavakyagragdgfictsgkgeelyteklmpavregaaaadr
    svdgidkmieikisydpdpelamnntrfwaplsltaeqkhsiddpiemekaadalpieqi
    akrwivasdpdeavekvgqyvtwglnhlvfhapghdqrrflelfqsdlaprlrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4yB (B:)
    elklgykasaeqfaprelvelavaaeahgmdsatvsdhfqpwrhqgghapfslswmtavg
    ertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgealneiatgyegaw
    pefkerfarlresvglmrqlwsgdrvdfdgdyyrlkgasiydvpdggvpvyiaaggpava
    kyagragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmieikisydpdpela
    mnntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpdeavekvgqyvt
    wglnhlvfhapghdqrrflelfqsdlaprlrr