PDB entry 3b4w

View 3b4w on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis aldehyde dehydrogenase complexed with NAD+
Class: oxidoreductase
Keywords: Rv0223c-NAD complex, Structural Genomics, PSI-2, Protein Structure Initiative, Integrated Center for Structure and Function Innovation, ISFI, TB Structural Genomics Consortium, TBSGC, Oxidoreductase
Deposited on 2007-10-24, released 2007-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0223c, MT0233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b4wa_
  • Heterogens: SO4, NAD, GOL, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b4wA (A:)
    msdsateydklfiggkwtkpstsdvievrcpatgeyvgkvpmaaaadvdaavaaaraafd
    ngpwpstppheraaviaaavkmlaerkdlftkllaaetgqpptiietmhwmgsmgamnyf
    agaadkvtwtetrtgsygqsivsrepvgvvgaivawnvplflavnkiapallagctivlk
    paaetpltanalaevfaevglpegvlsvvpggietgqaltsnpdidmftftgssavgrev
    grraaemlkpctlelggksaaiiledvdlaaaipmmvfsgvmnagqgcvnqtrilaprsr
    ydeivaavtnfvtalpvgppsdpaaqigplisekqrtrvegyiakgieegarlvcgggrp
    egldngffiqptvfadvdnkmtiaqeeifgpvlaiipydteedaiaiandsvyglagsvw
    ttdvpkgikisqqirtgtyginwyafdpgspfggyknsgigrengpegvehftqqksvll
    pmgytvagshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4wA (A:)
    sateydklfiggkwtkpstsdvievrcpatgeyvgkvpmaaaadvdaavaaaraafdngp
    wpstppheraaviaaavkmlaerkdlftkllaaetgqpptiietmhwmgsmgamnyfaga
    adkvtwtetrtgsygqsivsrepvgvvgaivawnvplflavnkiapallagctivlkpaa
    etpltanalaevfaevglpegvlsvvpggietgqaltsnpdidmftftgssavgrevgrr
    aaemlkpctlelggksaaiiledvdlaaaipmmvfsgvmnagqgcvnqtrilaprsryde
    ivaavtnfvtalpvgppsdpaaqigplisekqrtrvegyiakgieegarlvcgggrpegl
    dngffiqptvfadvdnkmtiaqeeifgpvlaiipydteedaiaiandsvyglagsvwttd
    vpkgikisqqirtgtyginwyafdpgspfggyknsgigrengpegvehftqqksvllpmg
    ytv