PDB entry 3b4t

View 3b4t on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis RNase PH, the Mycobacterium tuberculosis Structural Genomics Consortium target Rv1340
Class: transferase
Keywords: RNase, tRNA nucleotidyltransferase, ribonuclease, RPHA, Structural Genomics, TBSGC, Mycobacterium tuberculosis Structural Genomics Consortium, tRNA processing, TB Structural Genomics Consortium, PSI, Protein Structure Initiative, TRANSFERASE
Deposited on 2007-10-24, released 2007-11-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease PH
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: rph, rphA, Rv1340, MT1381, MTCY130.25, MTCY02B10.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b4ta1, d3b4ta2
  • Chain 'B':
    Compound: Ribonuclease PH
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: rph, rphA, Rv1340, MT1381, MTCY130.25, MTCY02B10.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b4tb1, d3b4tb2
  • Chain 'C':
    Compound: Ribonuclease PH
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: rph, rphA, Rv1340, MT1381, MTCY130.25, MTCY02B10.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b4tc1, d3b4tc2
  • Chain 'D':
    Compound: Ribonuclease PH
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: rph, rphA, Rv1340, MT1381, MTCY130.25, MTCY02B10.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b4td1, d3b4td2
  • Chain 'E':
    Compound: Ribonuclease PH
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: rph, rphA, Rv1340, MT1381, MTCY130.25, MTCY02B10.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b4te1, d3b4te2
  • Chain 'F':
    Compound: Ribonuclease PH
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: rph, rphA, Rv1340, MT1381, MTCY130.25, MTCY02B10.04
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b4tf1, d3b4tf2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b4tA (A:)
    gshvskredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwrkatg
    lgwltaeyamlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaid
    cdvlqadggtrtaaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvd
    lpyeedsraevdmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrd
    alalpypgvlpqgppppkafgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4tA (A:)
    skredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvpatglgwltaey
    amlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvlqadg
    gtrtaaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvdlpyeedsr
    aevdmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrdalalpypg
    vlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b4tB (B:)
    gshvskredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwrkatg
    lgwltaeyamlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaid
    cdvlqadggtrtaaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvd
    lpyeedsraevdmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrd
    alalpypgvlpqgppppkafgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4tB (B:)
    kredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvplgwltaeyamlp
    sathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvlqadggtrt
    aaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvdlpyeedsraevd
    mnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrdalalpypgvlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b4tC (C:)
    gshvskredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwrkatg
    lgwltaeyamlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaid
    cdvlqadggtrtaaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvd
    lpyeedsraevdmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrd
    alalpypgvlpqgppppkafgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4tC (C:)
    kredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwlgwltaeyam
    lpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvlqadggt
    rtaaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvdlpyeedsrae
    vdmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrdalalpypgvl
    p
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b4tD (D:)
    gshvskredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwrkatg
    lgwltaeyamlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaid
    cdvlqadggtrtaaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvd
    lpyeedsraevdmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrd
    alalpypgvlpqgppppkafgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4tD (D:)
    kredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvplgwltaeyamlp
    sathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvlqadggtrt
    aaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvdlpyeedsraevd
    mnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrdalalpypgvlp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3b4tE (E:)
    gshvskredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwrkatg
    lgwltaeyamlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaid
    cdvlqadggtrtaaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvd
    lpyeedsraevdmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrd
    alalpypgvlpqgppppkafgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4tE (E:)
    skredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvplgwltaeyaml
    psathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvlqadggtr
    taaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvdlpyeedsraev
    dmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrdalalpypgvlp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3b4tF (F:)
    gshvskredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwrkatg
    lgwltaeyamlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaid
    cdvlqadggtrtaaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvd
    lpyeedsraevdmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrd
    alalpypgvlpqgppppkafgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4tF (F:)
    skredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvplgwltaeyaml
    psathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvlqadggtr
    taaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvdlpyeedsraev
    dmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrdalalpypgvlp