PDB entry 3b4m

View 3b4m on RCSB PDB site
Description: Crystal Structure of Human PABPN1 RRM
Class: RNA binding protein
Keywords: RRM fold, ALPHA-BETA Sandwich structure, RNA Binding Domain, RNA Recognition Motif, Acetylation, Alternative splicing, Coiled coil, Cytoplasm, Disease mutation, Methylation, mRNA processing, Nucleus, Polymorphism, RNA-binding, Triplet repeat expansion, RNA BINDING PROTEIN
Deposited on 2007-10-24, released 2008-01-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: 0.229
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyadenylate-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PABPN1, PAB2, PABP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b4ma_
  • Chain 'B':
    Compound: Polyadenylate-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PABPN1, PAB2, PABP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b4mb_
  • Chain 'C':
    Compound: Polyadenylate-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PABPN1, PAB2, PABP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b4mc_
  • Chain 'D':
    Compound: Polyadenylate-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PABPN1, PAB2, PABP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b4md_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b4mA (A:)
    meadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesv
    rtslaldeslfrgrqikvipkrtnrpgilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4mA (A:)
    adarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrt
    slaldeslfrgrqikvipkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b4mB (B:)
    meadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesv
    rtslaldeslfrgrqikvipkrtnrpgilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4mB (B:)
    adarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrt
    slaldeslfrgrqikvipkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b4mC (C:)
    meadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesv
    rtslaldeslfrgrqikvipkrtnrpgilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4mC (C:)
    adarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrt
    slaldeslfrgrqikvipkr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b4mD (D:)
    meadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesv
    rtslaldeslfrgrqikvipkrtnrpgilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4mD (D:)
    adarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrt
    slaldeslfrgrqikvipk