PDB entry 3b4d

View 3b4d on RCSB PDB site
Description: Crystal Structure of Human PABPN1 RRM
Class: RNA binding protein
Keywords: RRM fold, ALPHA-BETA Sandwich structure, RNA Binding Domain, RNA Recognition Motif, Acetylation, Alternative splicing, Coiled coil, Cytoplasm, Disease mutation, Methylation, mRNA processing, Nucleus, Polymorphism, RNA-binding, Triplet repeat expansion, RNA BINDING PROTEIN
Deposited on 2007-10-24, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyadenylate-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PABPN1, PAB2, PABP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b4da_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b4dA (A:)
    meadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesv
    rtslaldeslfrgrqikvipkrtnrpgilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b4dA (A:)
    adarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrt
    slaldeslfrgrqikvipkr