PDB entry 3b3t

View 3b3t on RCSB PDB site
Description: Crystal structure of the D118N mutant of the aminopeptidase from Vibrio proteolyticus
Class: hydrolase
Keywords: alpha beta, Aminopeptidase, Hydrolase, Metal-binding, Protease, Secreted, Zinc, Zymogen
Deposited on 2007-10-22, released 2007-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.143
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial leucyl aminopeptidase
    Species: Vibrio proteolyticus [TaxId:671]
    Gene: AAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01693 (0-290)
      • engineered (117)
    Domains in SCOPe 2.03: d3b3ta_
  • Heterogens: ZN, NA, SCN, ILE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3b3tA (A:)
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgaddnas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg