PDB entry 3b32

View 3b32 on RCSB PDB site
Description: Crystal Structure of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75
Class: metal binding protein
Keywords: Calmodulin, EF hand motif, N-terminal domain, N-domain, Residues 1-75, Methylation, Phosphorylation, METAL BINDING PROTEIN
Deposited on 2007-10-19, released 2007-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62161 (Start-74)
  Domains in SCOPe 2.08: d3b32a_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3b32A (A:)
  adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
  gtidfpefltmmark
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3b32A (A:)
  dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
  tidfpefltmmark