PDB entry 3b2v

View 3b2v on RCSB PDB site
Description: Crystal structure of the extracellular region of the epidermal growth factor receptor in complex with the Fab fragment of IMC-11F8
Class: immune system/transferase
Keywords: CELL SURFACE RECEPTOR; GLYCOPROTEIN; ANTIGEN:ANTIBODY COMPLEX; FAB FRAGMENT; ANTITUMOR; DRUG, Anti-oncogene, ATP-binding, Cell cycle, Disease mutation, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Secreted, Transferase, Transmembrane, Tyrosine-protein kinase, IMMUNE SYSTEM-TRANSFERASE COMPLEX
Deposited on 2007-10-19, released 2008-02-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.286
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: IMC-11F8 FAB Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2V (0-End)
    Domains in SCOPe 2.02: d3b2vh1, d3b2vh2
  • Chain 'L':
    Compound: IMC-11F8 FAB Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2V (0-212)
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download) 
    >3b2vH (H:)
qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

    Sequence, based on observed residues (ATOM records): (download) 
    >3b2vH (H:)
qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
sastkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

  • Chain 'L':
    No sequence available.